Snoovatar

/u/ImClaaara

Last updated 4 minutes ago

Summary #

Your best, your worst and the basics.

Limited to the 1000 most recent submissions and comments.

redditor since

Jul 23, 2022

4 years ago

data available from

Jun 08, 2023

longest period between two consecutive posts

1 week

May 09, 2026 to May 22, 2026

gilded

0 submissions and 0 times from comments

submission karma

2980 from 57 submissions

52.28 average karma per submission

1617 total submission karma reported by reddit

comment karma

18206 from 1827 comments

9.96 average karma per comment

19380 total comment karma reported by reddit

best comment

Cabinets just keep you from seeing the skittering critters that flit around just out of sight and out of mind.... all over your plates and in your bowls and stuff. That's why I always grab the second plate in any stack and *never* the top one... (permalink)

worst comment

> I still just don’t know a lot of the “politics” in the trans community this sub is a space where right-wing trans people gather to discuss "controversial" topics about transness. what this usually translates to is threads like this, where they express contempt for trans people who aren't like them, or whose transition isn't strictly from one binary gender to the other. I come here out of morbid curiosity when I see a reference to the sub sometimes, but honestly, for your mental health, avoid places like this just as much as you'd avoid a dedicated TERF sub. (permalink)

best submission

I'm a trans woman. My mom just pulled my sister aside and asked her why I, and other trans people, are so worried about Trump being elected. (permalink)

worst submission

Cursor Stuck in Middle of Screen When Using Some Linux Games (permalink)

Synopsis #

Accuracy or making sense not guaranteed. Results may be incorrect or misleading.

Uncertain data is in orange. Follow # links for sources.

you have these pets

cat # # # # # # # #

you like to read

fiction, specific series: locked t…

Other

law

you like to play

ftl

you are

female # # # # # #

female

Health

transgender health and lgbt care

sports and teams you like

college football

transgender community

you like to discuss

geography

you like to discuss

personal finance

things you've said you like

iss over regular suspension #

you like to discuss

lgbt

spiders

female fashion

discussion

thredup and consignment/thrift sto…

bumper stickers

skincare

your locations of interest

vermont

city living and relocation

mississippi

florida

you are

outsider #

adhd #

tomboy #

weirdo #

woman * #

sex #

bottom #

trans #

fully-independent adult #

you like to discuss

linux

tablets

android apps and open source softw…

gadgets

dumbphones and feature phones

chrome

data

sysadmin

you like to watch

adventure time

you live(d)

in mississippi # #

in vermont #

in us #

in safer place #

in quaint little small town #

in town #

in blue/ state #

in dorm room #

in rural area #

you like

youtube music

humor and parody

tiktok content

memes

viral videos and stunts

clever comebacks

people in your family

mother # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #

father # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #

sister # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #

Political_View

libertarian

conservative

News And Politics

federal employees and us federal g…

politics

elections and electoral processes

u.s. politics and conservatism

world news

air force

libertarianism

anarchism

democratic politics

conservative

you are in a relationship with your

girlfriend # #

Religion And Spirituality

christianity

Social Science And Humanities

transgender issues

transgender issues

lgbtq+ parenting

you have a

Your top subs #

Earn karma responsibly... ;)

Based on your average karma earnings.

Best Average Karma

387 karma/submission on average

387 total karma over 1 submissions

320 karma/comment on average

320 total karma over 1 comments

Worst Average Karma

1 karma/submission on average

1 total karma over 1 submissions

0.33 karma/comment on average

1 total karma over 3 comments

Activity Over Last 60 Days #

If not on reddit, what are we?

Darker dots mean more activity. All times in UTC

Created with Highcharts 11.4.5
Created with Highcharts 11.4.5PostsKarma

Activity Timeline #

First they came for the lurkers...

Hover over the circles for more info.

Created with Highcharts 11.4.5PostsKarma2022-072022-112023-032023-072023-112024-032024-072024-112025-032025-072025-112026-032026-07060012001800240030000306090120150

Activity by Weekday #

Have you tried /r/outside?

Hover over the bars for more info.

Created with Highcharts 11.4.5KarmaPostsPostsKarmaSunMonTueWedThuFriSat

Activity by Time of Day #

Sleep (noun) - Period right after this one last reddit post.

Hover over the bars for more info. All times in UTC

Created with Highcharts 11.4.5KarmaPostsPostsKarma9111315171921231357

Posts Across Topics #

Look at you, how versatile!

Hover over the chart for more info.

Created with Highcharts 11.4.5AllLifestyleLGBTGenericGeneralGener…DiscussionDis…Gender-specificGen…GenericGen…GenericGen…GenericGen…News and PoliticsNew…Government and MilitaryGov…Federal Employees and US Federal GovernmentFedera…PoliticsPoli…GenericGen…LocationsLoc…United StatesUni…VermontVer…Social Science and HumanitiesSoc…LGBTTransgender IssuesTra…Transgender IssuesTra…TechnologyTec…SoftwareSof…OtherOth…EntertainmentEnt…YouTube MusicYou…College FootballColl…

Submissions By Type and Domain #

You're still the master of your domains.

Hover over the chart for more info.

Created with Highcharts 11.4.5AllSelfbugsasktransgenderasktra…frameworkframe…ExPentecostalExPen…ftlgameftlga…cfbmetacfbme…DemonolatryPracticesDemo…TransDIYTrans…antiworkantiw…EnhancementEnhan…dumbphonesdumb…linuxaudiolinuxa…Defeat_Project_2025Defea…androidappsandroi…MtFExvangelicalExvan…transfitnesstransf…CrostiniCrosti…RemarkableTabletRemar…minoxidilminox…UUredditUUred…youtubeyoutu…youtubedlyoutu…Amtrakchromeoschrom…ADHDTransyTalkTrans…mobiscribemobis…OldLanderOldLa…ninjacreamininjac…transnordtransn…awsDrWillPowersDrWill…KnyttImagei.redd.iti.redd…imgur.comimgur.…Otherreddit.comreddit…i.redd.iti.redd…oc-media.orgoc-me…wjtv.comwjtv.c…

Activity Across Subreddits (by Karma) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5ExPentecostalExPe…FemmeFitnessF…armedsocialistsarm…transnordtr…Transgender_SurgeriesTransgen…TransyTalkchaosmagickch…cisparenttranskidci…egg_irle…traumatizeThemBacktra…ExvangelicalExv…LetGirlsHaveFunLetGir…MtFOpenChristianOpenCh…TheGirlSurvivalGuideThe…ThredUpT…TransChristianityT…UUredditU…asktransgenderexchristianexchristi…ftmspidersspide…transtransgendertransvoicetra…TheNinthHouseThe…TikTokCringeTikT…YoutubeMusicYou…adventuretimead…nextfuckinglevelne…AskRedditAskRedd…AskWomenBlackPeopleTwitterBlac…OutOfTheLoopO…PublicFreakoutP…WellthatsucksWelltha…facepalmfa…interestingasfucki…meirlmildlyinfuriatingm…oddlysatisfyingo…oddlyterrifyingoddlyter…picstodayilearnedtoda…AirForceAi…Defeat_Project_2025Defeat_P…KamalaHarrisKa…RightJerkR…antiworkan…fednewsnewsn…nottheonionn…politicssomethingiswrong2024something…worldnewswo…AmerExitA…SameGrassButGreenerSam…canadaca…floridaflo…mississippimis…vermontGeorgiaOrGeorgiaG…occulto…CFBDataHoarderD…RemarkableTabletRe…dataisbeautifuldat…fossdroidf…frameworkfra…linuxtechnologytech…MapPornMa…biologybi…ftlgameftl…pcmasterracep…normalnudesnormalnu…

Activity Across Subreddits (by Posts) #

Where might /r/random take you next?

Hover for more info.

Created with Highcharts 11.4.5AmIOverreactingA…ColorCrewC…ExPentecostalExPente…FemmeFitnessFe…armedsocialistsar…intersexi…minoxidilm…netballnet…transnordtr…Transgender_SurgeriesTransgen…TransyTalkTransyTa…chaosmagickcha…cisparenttranskidcisp…egg_irle…traumatizeThemBackt…truscumtr…BumperstickersB…CatholicC…LetGirlsHaveFunLet…MtFOpenChristianOpe…SkincareAddictionS…TheGirlSurvivalGuideTheG…ThredUpT…TransChristianityTra…TransSpaceTr…UUredditU…asktransgenderexchristianexc…ftmf…spiderstranstransgendertranstimelinest…transvoicetrans…PeterExplainsTheJokeP…TheNinthHouseTh…TikTokCringeTi…YoutubeMusicYoutube…adventuretimeadv…clevercomebackscl…comicsc…nextfuckingleveln…shitpostings…whenthew…AdviceAnimalsA…AskRedditAskRe…AskWomenBlackPeopleTwitterBl…DamnthatsinterestingDa…MurderedByWordsM…OutOfTheLoopO…PublicFreakoutPub…WhitePeopleTwitterW…changemyviewc…facepalmface…funnyf…interestingasfuckint…meirlme…mildlyinfuriatingmildlyinfu…oddlyterrifyingodd…picsskepticske…therewasanattemptth…todayilearnedtoday…AirForceAirF…Anarchy101A…AskDemocratsA…ConservativeC…Defeat_Project_2025Defea…LibertarianLib…PoliticalHumorP…antiworka…fednewsnewsn…nottheonionno…politicssomethingiswrong2024some…worldnewsworl…AmerExitAm…SameGrassButGreenerSa…burlingtonbu…canadacana…europee…floridaflo…mississippimis…vermontoccultoc…CFBtransfitnesstr…DataHoarderD…RemarkableTabletRema…awsa…chromeosc…dumbphonesd…fossdroidfossd…linuxpebblepeb…technologytech…youtubedly…DrWillPowersD…GrimesG…JustUnsubbedJu…bugsb…helph…MapPornM…SteamS…ftlgameftlg…pcmasterracepc…RateMyNudeBodyRa…normalnudesn…sofis…wallstreetbetsw…lawninjacreamini…

Most Common Words #

Don't forget to use that new word you learned!

Size of a word is directly proportional to its frequency.

peopletranstimemakegoodthingsstartedbacklotworkthingstufffeelpointsexlifeyearshrtdayfindhonestlypersongenderprettystateyearwomanbodywomenstartparttransitionchangegiveputcouplevoicefolkscismadehomehairyeahcommunitylongmonthstalkingfriendstoldexperiencemakingsurgeryplacetalkmedicalendfriendjobparentsbasedcalledfamilyactualshitthoughtideatakingpublicbasicallywantedworldcarehouseleavesocialunderstandstophopeopenrealmakesabsolutelytrumprememberreadlivefeltweirdcomingmilitarysupportworkingcaselovepastredditbadmomheardheardayscallfacehardagostartingpostaskedwearthinkingfounddadgovernmentmenmeansguessweeksshowmovesystemchurchmalegrouptransitioningcommenthighfullhistorywearingknewfeelslivingweekapptellingpassreasonearlyfinallymediastaynormalrecommendredtestosteronefederalbottomlegalfuckingplanrunsmallincludingsafedysphoriaestradiollookedhumanidkguypaysimilarmusicbigsocietyschoolworkslawmindcheckhappeneventuallycountrytherapistpowerquestionpartnersensetimesbitmiddleorderfactmovedmanphonecomfortablechangedyoutubelongermississippifreeliterallysoundsclearchangingsimplyrightsgodsleep

Common Words Table #

Don't forget to use that new word you learned!

Your word frequency.

Word Frequency
people 1083
trans 625
time 449
make 387
good 323
things 320
started 319
back 318
lot 302
work 278
thing 269
stuff 254
feel 242
point 231
sex 229
life 228
years 221
hrt 217
day 207
find 202
honestly 202
person 200
gender 195
pretty 188
state 185
year 182
woman 181
body 177
women 176
start 173
part 173
transition 169
change 167
give 163
put 161
couple 158
voice 158
folks 145
cis 144
made 142
home 138
hair 138
yeah 132
community 127
long 125
months 125
talking 125
friends 124
told 124
experience 123
making 121
surgery 119
place 118
talk 116
medical 116
end 114
friend 111
job 110
parents 110
based 109
called 109
family 108
actual 108
shit 108
thought 107
idea 104
taking 103
public 103
basically 103
wanted 102
world 100
care 100
house 99
leave 98
social 98
understand 98
stop 97
hope 96
open 96
real 96
makes 96
absolutely 96
trump 95
remember 94
read 92
live 92
felt 91
weird 91
coming 91
military 91
support 90
working 89
case 88
love 88
past 87
reddit 87
bad 87
mom 86
heard 85
hear 83
days 83
call 83
face 83
hard 82
ago 81
starting 81
post 80
asked 80
wear 79
thinking 78
found 78
dad 77
government 76
men 75
means 75
guess 75
weeks 74
show 74
move 74
system 74
church 74
male 74
group 73
transitioning 73
comment 73
high 71
full 71
history 71
wearing 70
knew 70
feels 69
living 69
week 69
app 69
telling 69
pass 69
reason 68
early 68
finally 68
media 68
stay 68
normal 67
recommend 67
red 67
testosterone 67
federal 66
bottom 66
legal 66
fucking 66
plan 66
run 65
small 65
including 65
safe 65
dysphoria 65
estradiol 65
looked 64
human 64
idk 64
guy 64
pay 64
similar 64
music 64
big 63
society 63
school 63
works 63
law 63
mind 62
check 62
happen 62
eventually 62
country 62
therapist 62
power 61
question 61
partner 61
sense 61
times 61
bit 61
middle 60
order 60
fact 60
moved 60
man 60
phone 60
comfortable 60
changed 60
youtube 59
longer 59
mississippi 58
free 58
literally 58
sounds 58
clear 57
changing 57
simply 57
rights 57
god 56
sleep 56

Corpus Statistics #

If only you had typed this much for that college essay...

Time spent calculated using average of 40 WPM.

Your Typing Stats

total words in your posts

278305

unique words

16398 (5.89% of total words)

time spent typing posts

115.96 hours

karma per word

0.07