LOCUS       NZ_NRKI01000115          404 bp    DNA     linear   CON 05-AUG-2024
DEFINITION  Cronobacter sakazakii strain cro4114B1 contig115, whole genome
            shotgun sequence.
ACCESSION   NZ_NRKI01000115 NZ_NRKI01000000
VERSION     NZ_NRKI01000115.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN07483997
            Assembly: GCF_002977005.2
KEYWORDS    WGS; RefSeq.
SOURCE      Cronobacter sakazakii
  ORGANISM  Cronobacter sakazakii
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Cronobacter.
REFERENCE   1  (bases 1 to 404)
  AUTHORS   Zeng,H., Zhang,J., Wu,Q., He,W., Wu,H., Ye,Y., Li,C., Ling,N.,
            Chen,M., Wang,J., Cai,S., Lei,T., Ding,Y. and Xue,L.
  TITLE     Reconstituting the Evolutionary History of Cronobacter Driven by
            Differentiated CRISPR Activity
  JOURNAL   Appl. Environ. Microbiol. (2018) In press
REFERENCE   2  (bases 1 to 404)
  AUTHORS   Zeng,H. and Wu,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2017) State Key Laboratory of Applied
            Microbiology Southern China, Guangdong Provincial Key Laboratory of
            Microbial Culture Collection and Application, Guangdong Open
            Laboratory of Applied Microbiology, Guangdong Institute of
            Microbiology, Xianlie Zhong Road 100, Guangzhou, Guangdong 510070,
            China
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            NRKI01000115.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 3.6.2
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_002977005.2-RS_2024_08_05
            Annotation Date                   :: 08/05/2024 02:43:09
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 4,299
            CDSs (total)                      :: 4,156
            Genes (coding)                    :: 4,077
            CDSs (with protein)               :: 4,077
            Genes (RNA)                       :: 143
            rRNAs                             :: 9, 44, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 9, 1 (5S, 23S)
            partial rRNAs                     :: 44 (16S)
            tRNAs                             :: 78
            ncRNAs                            :: 11
            Pseudo Genes (total)              :: 79
            CDSs (without protein)            :: 79
            Pseudo Genes (ambiguous residues) :: 0 of 79
            Pseudo Genes (frameshifted)       :: 9 of 79
            Pseudo Genes (incomplete)         :: 66 of 79
            Pseudo Genes (internal stop)      :: 11 of 79
            Pseudo Genes (multiple problems)  :: 6 of 79
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..404
                     /organism="Cronobacter sakazakii"
                     /mol_type="genomic DNA"
                     /submitter_seqid="contig115"
                     /strain="cro4114B1"
                     /isolation_source="food"
                     /db_xref="taxon:28141"
                     /geo_loc_name="China"
                     /collection_date="2016"
                     /collected_by="Guangdong Institute of Microbiology"
     gene            <1..>404
                     /locus_tag="CI824_RS21300"
     CDS             <1..>404
                     /locus_tag="CI824_RS21300"
                     /inference="COORDINATES: protein motif:HMM:NF012726.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_158679784.1"
                     /translation="RPNNNTRKSISLAGGRALYATGNIIGDIRQAHCNVSKGNWTETL
                     GQVATKLREQFKNKTIVFNSSSGGDPEVEMFIFNCGGEFFYCNTSKLFNYTFLANGTG
                     QNYSTGNITIQCRIKQIINRWQEVGKAMYAPP"
ORIGIN      
        1 agacccaaca acaatacaag aaagagtata agtcttgcag gggggagagc attatatgca
       61 acaggaaaca taataggaga tataagacaa gcacattgta atgttagtaa aggaaattgg
      121 actgaaactt taggacaggt agctacaaaa ttaagagaac aatttaagaa taagacaata
      181 gtctttaact catcctcagg aggggatccc gaggttgaaa tgttcatatt taattgtgga
      241 ggggagtttt tctactgtaa tacatcaaaa ctgtttaatt atactttttt ggctaatggt
      301 actgggcaaa attacagtac tggaaatatc acaattcaat gcagaataaa acaaataata
      361 aacaggtggc aggaagtagg aaaagcaatg tatgcccctc ccat
//