LOCUS       JACOEC010000070          545 bp    DNA     linear   BCT 23-AUG-2020
DEFINITION  Klebsiella sp. Kpp NODE_70_length_545_cov_1.895299, whole genome
            shotgun sequence.
ACCESSION   JACOEC010000070 JACOEC010000000
VERSION     JACOEC010000070.1
DBLINK      BioProject: PRJNA656584
            BioSample: SAMN15634861
KEYWORDS    WGS.
SOURCE      Klebsiella sp. Kpp
  ORGANISM  Klebsiella sp. Kpp
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group;
            Klebsiella.
REFERENCE   1  (bases 1 to 545)
  AUTHORS   Franco,L.A., Soto,A.Y., Lau-Bonilla,D., Melgar,D.P., Figueroa,N.A.,
            Pennington,P.M., Ramirez,E.M. and Rendon,P.
  TITLE     Genome analysis of putative symbiotic bacteria of tephritid fruit
            flies
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 545)
  AUTHORS   Franco,L.A., Soto,A.Y., Lau-Bonilla,D., Melgar,D.P., Figueroa,N.A.,
            Pennington,P.M., Ramirez,E.M. and Rendon,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-AUG-2020) Departamento de Bioquimica y Microbiologia,
            Universidad del Valle de Guatemala, 18 Av. 11-95, Guatemala 01015,
            Guatemala
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Date             :: 18-JUN-2020
            Assembly Method           :: SPAdes v. 3.13.1
            Genome Representation     :: Full
            Expected Final Version    :: Yes
            Reference-guided Assembly :: GCA_002240335.1
            Genome Coverage           :: 93.89x
            Sequencing Technology     :: Illumina MiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 08/18/2020 19:41:27
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.12
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,450
            CDSs (total)                      :: 5,354
            Genes (coding)                    :: 5,248
            CDSs (with protein)               :: 5,248
            Genes (RNA)                       :: 96
            rRNAs                             :: 3, 4, 6 (5S, 16S, 23S)
            complete rRNAs                    :: 2 (5S)
            partial rRNAs                     :: 1, 4, 6 (5S, 16S, 23S)
            tRNAs                             :: 69
            ncRNAs                            :: 14
            Pseudo Genes (total)              :: 106
            CDSs (without protein)            :: 106
            Pseudo Genes (ambiguous residues) :: 0 of 106
            Pseudo Genes (frameshifted)       :: 44 of 106
            Pseudo Genes (incomplete)         :: 52 of 106
            Pseudo Genes (internal stop)      :: 29 of 106
            Pseudo Genes (multiple problems)  :: 17 of 106
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..545
                     /organism="Klebsiella sp. Kpp"
                     /mol_type="genomic DNA"
                     /submitter_seqid="NODE_70_length_545_cov_1.895299"
                     /strain="Kpp"
                     /isolation_source="adult insects fed artificial diets
                     based on hydrolized protein and sugar"
                     /host="Anastrepha ludens black pupae (BP) Genetic sexing
                     strain Guatemala-10 (aka Family 10)"
                     /db_xref="taxon:2758578"
                     /geo_loc_name="Guatemala: San Miguel Petapa Mass rearing
                     facility"
                     /altitude="1260 m"
                     /collection_date="11-Aug-2017"
                     /collected_by="San Miguel Petapa personnel and Dalia Lau"
     gene            complement(<1..>545)
                     /locus_tag="H8J58_26815"
     CDS             complement(<1..>545)
                     /locus_tag="H8J58_26815"
                     /inference="COORDINATES: protein motif:HMM:NF012719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=2
                     /transl_table=11
                     /product="hemagglutinin"
                     /protein_id="MBC3627349.1"
                     /translation="ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKKYVCSTK
                     LRLATGLRNKPSKQSQGLFGAIAGFTEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQ
                     NAIDEITNKVNSVIEKMNTQRTAIGCEYNKSERCMKQIEDKIEEIESKIWCYNAELLV
                     LLENQRTLDYHDSNVKNLYEK"
ORIGIN      
        1 ccttctcata cagattcttc acgttgctgt cgtggtagtc cagggtccgc tgattctcga
       61 gcagcaccag cagctcggcg ttatagcacc agatcttaga ctcgatctcc tcgatcttgt
      121 cctcgatctg cttcatgcac ctctcggact tattgtactc gcagccgatg gctgtccgct
      181 gggtgttcat cttctcgatc acgctattga ccttgtttgt gatctcatca atggcattct
      241 gggtagactt caggtcagca gcatatccag atccctgctc attctggtgg tgatagccgt
      301 accagccatc caccatgcct gtccagccgc cctcggtaaa gcctgcaatt gctccaaaca
      361 ggccctggct ctgcttgctg ggcttgtttc tcaggcctgt ggccagcctc agcttggtgc
      421 tgcagacgta cttcttatcc tccagcagat tcacagagtg tgtcacggtc acgttcttct
      481 ccagcacggt atccactgtg tcggtagagt tgttagcgtg gtacccgatg cacagggtat
      541 cagcg
//