LOCUS       NZ_JABACS010000218       812 bp    DNA     linear   CON 21-SEP-2024
DEFINITION  Escherichia coli strain 10 Ecoli10_contig00218, whole genome
            shotgun sequence.
ACCESSION   NZ_JABACS010000218 NZ_JABACS010000000
VERSION     NZ_JABACS010000218.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN14572048
            Assembly: GCF_013185885.1
KEYWORDS    WGS; RefSeq.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 812)
  AUTHORS   Krijger,M., Van Overbeek,L., Wichers,J., Van Amerongen,A., Van
            Roermund,H., Van Der Zouwen,P. and Willemsen,P.
  TITLE     Circulation of Shiga toxin-producing Escherichia coli phylogenetic
            group B1 strains between calve stable manure and pasture land with
            grazing heifers
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 812)
  AUTHORS   Krijger,M., Van Overbeek,L., Wichers,J., Van Amerongen,A., Van
            Roermund,H., Van Der Zouwen,P. and Willemsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2020) Biointeractions & Planthealth, Wageningen
            University & Research, Droevendaalsesteeg, Wageningen, Gelderland
            6708PB, Netherlands
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            JABACS010000218.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: APR-2018
            Assembly Method        :: Shovill suit v. 1.0.9
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 148x
            Sequencing Technology  :: Illumina MiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_013185885.1-RS_2024_09_21
            Annotation Date                   :: 09/21/2024 05:10:48
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.8
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 5,535
            CDSs (total)                      :: 5,433
            Genes (coding)                    :: 5,073
            CDSs (with protein)               :: 5,073
            Genes (RNA)                       :: 102
            rRNAs                             :: 1, 3, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1 (5S)
            partial rRNAs                     :: 3, 1 (16S, 23S)
            tRNAs                             :: 88
            ncRNAs                            :: 9
            Pseudo Genes (total)              :: 360
            CDSs (without protein)            :: 360
            Pseudo Genes (ambiguous residues) :: 0 of 360
            Pseudo Genes (frameshifted)       :: 128 of 360
            Pseudo Genes (incomplete)         :: 224 of 360
            Pseudo Genes (internal stop)      :: 80 of 360
            Pseudo Genes (multiple problems)  :: 63 of 360
            CRISPR Arrays                     :: 1
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..812
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /submitter_seqid="Ecoli10_contig00218"
                     /strain="10"
                     /serotype="O98:H21"
                     /isolation_source="stable manure"
                     /db_xref="taxon:562"
                     /geo_loc_name="Netherlands"
                     /collection_date="2014"
                     /collected_by="Wageningen Univeristy and Research"
     gene            104..>812
                     /locus_tag="HRL07_RS27090"
     CDS             104..>812
                     /locus_tag="HRL07_RS27090"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /GO_component="GO:0019031 - viral envelope [Evidence IEA]"
                     /GO_function="GO:0046789 - host cell surface receptor
                     binding [Evidence IEA]"
                     /GO_process="GO:0019064 - fusion of virus membrane with
                     host plasma membrane [Evidence IEA]"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin"
                     /protein_id="WP_214666741.1"
                     /translation="MLATGMKNVPEIPKGRGLFGAIAGFIENGWEGLIDGWYGFKHQN
                     AQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFESIDNEFTEVEKQIGNVINWTRD
                     SMTEVWSYNAELLVAMENQHTIDLADSEMNKLYERVRRQLRENAEEDGTGCFEIFHKC
                     DDDCMASIRNNTYDHSKYREEAMQNRIQIDPVKLSSGYKDVVLWFSFGASCFILLAIA
                     MGLVFICVKNGNMRCTIC"
ORIGIN      
        1 ttgctatcac agcggaggga caataataag taatttgccc tttcagaata taaatagcag
       61 ggctgtagga aaatgtccga gatatgttaa gcaagagagt ctgatgctag caaccggaat
      121 gaaaaacgtt cctgaaatcc caaagggaag aggcctattt ggtgctatag cgggattcat
      181 tgaaaatgga tgggaaggcc tgattgatgg atggtatggc ttcaagcatc aaaatgcaca
      241 aggagaggga actgctgcag attacaaaag cacccaatca gcaatcgatc aaataacagg
      301 aaaattaaac cggcttatag aaaaaactaa ccaacaattt gagtcgatag acaatgaatt
      361 cactgaggtt gagaagcaaa ttggcaacgt gataaattgg accagagatt ccatgacaga
      421 agtgtggtcc tataacgctg aactcttggt agcaatggaa aatcagcaca caattgatct
      481 ggccgactca gaaatgaaca aactatacga acgagtgagg aggcaactga gagagaatgc
      541 tgaagaagat ggcactggct gttttgaaat attccacaaa tgtgatgacg actgcatggc
      601 cagtattagg aacaacacct atgatcacag caagtacaga gaagaggcaa tgcaaaatag
      661 aatacagatt gacccagtca aactaagcag cggttacaaa gatgtggtac tttggtttag
      721 cttcggggca tcatgtttca tacttctggc cattgcaatg ggccttgtct tcatatgtgt
      781 gaagaatgga aacatgcggt gcactatttg ta
//