Carbonic Anhydrase 8 Protein, Human (His)

Carbonic Anhydrase VIII/CA8 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 8 (CA8), an isozyme of α-carbonic anhydrases (CAs), is an allosteric inhibitor of inositol trisphosphate receptor-1 (ITPR1), which regulates neuronal intracellular calcium release^[1][2].

CA8 overexpression desensitizes neuronal cells to STS induced apoptotic stress and increases cell migration and invasion ability in neuronal cells. In addition, down-regulated CA8 decreases neuron mobility in neuronal cells and leads to abnormal calcium release in cerebellar granule neurons. Knockdown of the ca8 gene results in an abnormal movement pattern in zebrafish^[2].

Human

E. coli

P35219 (A2-Q290)

767

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQHHHHHH

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5 .

<1 EU/μg, determined by LAL method.

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Gerald Z Zhuang, et al. Human carbonic anhydrase-8 AAV8 gene therapy inhibits nerve growth factor signaling producing prolonged analgesia and anti-hyperalgesia in mice. Gene Ther. 2018 Jul;25(4):297-311.

  [2]. Min-Syuan Huang, et al. Roles of carbonic anhydrase 8 in neuronal cells and zebrafish. Biochim Biophys Acta. 2014 Sep;1840(9):2829-42.